Forum:Yay
Jump to navigation
Jump to search
Visitors to illogicopedia are up 70%, and the domain is worth $2781.3 USD. Hippo.--(ƒî)» 01:51, 21 Octodest 2009 (UTC)
- how the hell do you know this —rms talk 02:38, 21 Octodest 2009 (UTC)
- Illogicopedia is the 765,488th best website in the United States. -- Dxpenguinman, the Penguinman ...He's e-vile! • Talk • Got An Idea? • GAMESHOW! 03:15, 21 Octodest 2009 (UTC)
- I feel accomplished —rms talk 03:17, 21 Octodest 2009 (UTC)
- Search terms that drive traffic to Illogicopedia include David Cameron, Hamster on a keyboard and Bazouga. -- Dxpenguinman, the Penguinman ...He's e-vile! • Talk • Got An Idea? • GAMESHOW! 03:21, 21 Octodest 2009 (UTC)
- Pageviews are up 300% since july, but people are now spending 25% less time on the actual pages.--Ben Blade 06:22, 21 Octodest 2009 (UTC)
- RMS's page is amazingly the 8th most viewed page with a total of 1972 pageviews. The top is the main page with a total of 51,017. --61.6.241.20 09:03, 21 Octodest 2009 (UTC)
- David Cameron? Wow, I remember that being cobbled together from old Wikipedia snippets. Also, if we're gonna get all geeky, Illogicopedia is the 42,305th most popular website in Canada and according to Alexa, the most popular search term is 'Wikipedia heroes'. We could be heroes... just for one day. -- Hindleyak Converse • ?blog • Click here! 09:47, 21 Octodest 2009 (UTC)
- RMS's page is amazingly the 8th most viewed page with a total of 1972 pageviews. The top is the main page with a total of 51,017. --61.6.241.20 09:03, 21 Octodest 2009 (UTC)
- Pageviews are up 300% since july, but people are now spending 25% less time on the actual pages.--Ben Blade 06:22, 21 Octodest 2009 (UTC)
- Search terms that drive traffic to Illogicopedia include David Cameron, Hamster on a keyboard and Bazouga. -- Dxpenguinman, the Penguinman ...He's e-vile! • Talk • Got An Idea? • GAMESHOW! 03:21, 21 Octodest 2009 (UTC)
- I feel accomplished —rms talk 03:17, 21 Octodest 2009 (UTC)
More stats[edit source]
The most linked-to pages are:
- Illogicopedia:Browse (1,725 links)
- User:Hindleyite (1,547 links)
- User talk:Hindleyite (1,375 links)
- The oldest page is Y
The most popular pages are:
- Main Page (51,126 views)
- Encyclopedia Dramatica (2,271 views)
- Colonel Sanders (1,618 views)
- NASA (1,198 views)
- IllogiNews (1,055 views)
'The longest (and most repetitive) pages are:
The longest titles are:
- Vqtxuzhvscjzrakrelfvoctrlmxklmxvbvymmlvwbsfammmjsvdhscpbbnkxbomfuftfhdllnhfglckeuzmgwsmsszzqedmjabaruzhtjjueqjqsiztmysijwrmgatssuvrfmurfdrcczlrzxhdncbruoxgsmmqjosjqyjmcmmvtisnbdiywmevzwhrcaioirqkztrtamhqwcwsjgsenucbrcjhiwujohadxdhojlqnhuinvbyisoldxxvqldbb
- Eeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeee
- Omgimtypingrandomsymbolsthisisthebestarticleevarevengodcantbeatthisbecauseimsocoolandhesnotsogosuckacockgodbecauseiamgodnowfortypingouttheserandomlettersandiwillbeprevelentgodbecauseijustpwnedyouwiththislongbutttitlenowpleasegtfoandtakeyourselfwithyounow!
- The article with the longest title ever for a wiki article, it's so long that you wouldn't probably remember it but who care's it's long and wide and that's what people care about is how long it is and longer is better then shorter based on common law
- Krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphopnopparatrajathaniburiromudomrajaniwesmahasatharnamornphimarnavatarnsathitsakkattiyavisanukamprasit
The most used files are:
The most used categories are:
- Category:Moved From Uncyclopedia (508 members)
- Category:Templates (381 members)
- Category:People (346 members)
Anagrams for Hindleyak:
- handlikey
- inhaled ky
- Leaky Hind
- Had Ye Link
Anagrams For Silent Penguin
- unsleeping int.
- Single Pen Unit
- Pulsing in Teen
- Insulting Peen
- Sleeping Ti Nun
Anagrams for Benedict Blade
- I C dented babel
- decident babel
- Tabbed Decline
- Bendable diet c.
- End Tabbed Lice
Anagrams for Dxpenguinman, the Penguinman
- unexpanding unhingement map
- unexpanding manhunting pee m
- A Amendment Expunging Hip Nun
- Thin Madman Expunging Nun Pee
- Painted Ex-Gunmen Humping Ann
Forum continues Below[edit source]
- Geekalogical comment: Polite correction on the oldest article being 'y'... see this blog post for more info! I also would like to express my distaste for the 'wheeeee' article. -- Hindleyak Converse • ?blog • Click here! 21:16, 21 Octodest 2009 (UTC)
- Ah, I see. And I second your distaste for Wheeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeee and also Eeeeeeeeeeeeeeeeeeeeeeeeeeee.
Shall I orbit a VFD axe around them? --The preceding unsigned comment was left by Flyingidiot (talk | stalk), see the past frenzies page for posting time- They're pretty much staple Illogico fare from the Wikia days, and I know a few Illogico users like them. I suggest sticking a forum topic up first and getting peoples' attention by placing a catchy news link on the front page. -- Hindleyak Converse • ?blog • Click here! 11:52, 22 Octodest 2009 (UTC)
- Ah, I see. And I second your distaste for Wheeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeee and also Eeeeeeeeeeeeeeeeeeeeeeeeeeee.
Newer info[edit source]
As of november 2009, pageviews are now up 880% since september. Time spent on pages has improved greatly, 280% since September.--Ben Blade 21:35, 12 Novelniver 2009 (UTC)
- Wow, is that correct? Carlb, we really need access to the webaliser or whatever for Illogicopedia, NOW! -- Hindleyak Converse • ?blog • Click here! 12:32, 13 Novelniver 2009 (UTC)